Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_810994 (POPTRDRAFT_810994)
This Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_810994 (POPTRDRAFT_810994) spans the amino acid sequence from region 1-163.
Product Specifications
Product Name Alternative
CASP-like protein POPTRDRAFT_810994
UniProt
B9N3F4
Expression Region
1-163
Origin
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAKSNKIFTNTLRLLALAATVVAIVFMVTSHDSAQVLNLTFTAKYSNTPAFKYLVIGEAI AGGYTVISILLSFKGLFWRLIVILDMVTTVLLTSSISAALAIAQVGKKGNTHAGWLPICG QVPDFCDYVTIALIAGFAAAIIYFVLLLCSLYVVLSPIFVATP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680630-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040488-500 1x 500 µL
Topoisomerase I, MT (TOP1MT/488), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 