Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 128 (Tmem128)

This Recombinant Mouse Transmembrane protein 128 (Tmem128) spans the amino acid sequence from region 1-163.

Product Specifications

Product Name Alternative

Transmembrane protein 128

UniProt

Q9CZB9

Expression Region

1-163

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAPWAREQLRRRYLFPSEVELDCEDEAKPETPTAVEKKERPLPRLNIHSGFWILASIVV TYYVDFFKTFKENFHTNSWFLFGGALLFVSLSIAFYCIVYLEWYRGIEEYDVKYPTLVPI TTATFIAAGICFNLALWNVWSFFTPLLLFTQFMGVVMFISLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant DDX39B Antibody
RC-16094-01 50 μL

Recombinant DDX39B Antibody

Sign In for Pricing
View Details
Recombinant DDX39B Antibody
RC-16094-02 100 µL

Recombinant DDX39B Antibody

Sign In for Pricing
View Details
Recombinant DDX39B Antibody
RC-16094-03 1 mL

Recombinant DDX39B Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Prostate
CR560919 5 µg

Tissue Total RNA, Prostate

Sign In for Pricing
View Details
ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI4H7]
CF810112 100 µg

ZFYVE1 Mouse Monoclonal Antibody [Clone ID: OTI4H7]

Sign In for Pricing
View Details
(±)-Cryptone
TRC-C827465-250MG 250 mg

(±)-Cryptone

Sign In for Pricing
View Details