Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epithelial membrane protein 3 (EMP3)

This Recombinant Human Epithelial membrane protein 3 (EMP3) spans the amino acid sequence from region 1-163.

Product Specifications

Product Name Alternative

Epithelial membrane protein 3, EMP-3, Hematopoietic neural membrane protein 1, HNMP-1, Protein YMP

UniProt

P54852

Expression Region

1-163

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSEN GWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAI HAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REXO1L5P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1810708 1.0 µg DNA

REXO1L5P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Granzyme B(G,H) ELISA Kit
MBS2886338-01 48 Well

Mouse Granzyme B(G,H) ELISA Kit

Sign In for Pricing
View Details
Mouse Granzyme B(G,H) ELISA Kit
MBS2886338-02 96 Well

Mouse Granzyme B(G,H) ELISA Kit

Sign In for Pricing
View Details
Mouse Granzyme B(G,H) ELISA Kit
MBS2886338-03 5x 96 Well

Mouse Granzyme B(G,H) ELISA Kit

Sign In for Pricing
View Details
Mouse Granzyme B(G,H) ELISA Kit
MBS2886338-04 10x 96 Well

Mouse Granzyme B(G,H) ELISA Kit

Sign In for Pricing
View Details
SH3RF3 Antibody
DF4504-01 100 µL

SH3RF3 Antibody

Sign In for Pricing
View Details