Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epithelial membrane protein 3 (EMP3)

This Recombinant Human Epithelial membrane protein 3 (EMP3) spans the amino acid sequence from region 1-163.

Product Specifications

Product Name Alternative

Epithelial membrane protein 3, EMP-3, Hematopoietic neural membrane protein 1, HNMP-1, Protein YMP

UniProt

P54852

Expression Region

1-163

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSEN GWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAI HAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galectin 10 Rabbit pAb, BF700 conjugated
orb2878174 100 µL

Galectin 10 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Lep ORF Vector (Rat) (pORF)
26443016 1.0 µg DNA

Lep ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Purinergic Receptor P2Y, G-Protein coupled, 1
331468 100 µL

Purinergic Receptor P2Y, G-Protein coupled, 1

Sign In for Pricing
View Details
FOXK2 Rabbit pAb
A14245-01 100 μL

FOXK2 Rabbit pAb

Sign In for Pricing
View Details
FOXK2 Rabbit pAb
A14245-02 20 µL

FOXK2 Rabbit pAb

Sign In for Pricing
View Details
FOXK2 Rabbit pAb
A14245-03 500 μL

FOXK2 Rabbit pAb

Sign In for Pricing
View Details