What is the catalog number for Recombinant Mouse Epithelial membrane protein 3 (Emp3)?

The catalog number for Recombinant Mouse Epithelial membrane protein 3 (Emp3) is orb2920396.

What sizes are available for Recombinant Mouse Epithelial membrane protein 3 (Emp3)?

Recombinant Mouse Epithelial membrane protein 3 (Emp3) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Mouse Epithelial membrane protein 3 (Emp3) come in?

Recombinant Mouse Epithelial membrane protein 3 (Emp3) is available in 2 different pack sizes.

Recombinant Mouse Epithelial membrane protein 3 (Emp3)

Q: Is Recombinant Mouse Epithelial membrane protein 3 (Emp3) in stock?

Recombinant Mouse Epithelial membrane protein 3 (Emp3) is currently made to order / not held in immediate stock. Contact us for lead time.

This Recombinant Mouse Epithelial membrane protein 3 (Emp3) spans the amino acid sequence from region 1-163.

Product Specifications

Product Name Alternative

Epithelial membrane protein 3, EMP-3, Hematopoietic neural membrane protein 1, HNMP-1, Protein YMP

UniProt

O35912

Expression Region

1-163

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLLLVVSALHILILVLLFVATLDKSWWTLPDKESLNLWYDCTWNTTTQTWACSNVSEN GWLKAVQALMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSAAVFSGALIYAI HTEEILAKHPSGGSFGYCFALAWVAFPLALVSGIVYIHLRKRE