Recombinant Mouse Epithelial membrane protein 3 (Emp3)
This Recombinant Mouse Epithelial membrane protein 3 (Emp3) spans the amino acid sequence from region 1-163.
Product Specifications
Product Name Alternative
Epithelial membrane protein 3, EMP-3, Hematopoietic neural membrane protein 1, HNMP-1, Protein YMP
UniProt
O35912
Expression Region
1-163
Origin
Mus musculus (Mouse)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLLLLVVSALHILILVLLFVATLDKSWWTLPDKESLNLWYDCTWNTTTQTWACSNVSEN GWLKAVQALMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSAAVFSGALIYAI HTEEILAKHPSGGSFGYCFALAWVAFPLALVSGIVYIHLRKRE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
317899-01 50 µg
CSF2RA (Granulocyte-macrophage Colony-stimulating Factor Receptor Subunit alpha, GM-CSF-R-alpha, GMCSFR-alpha, GMR-alpha, CDw116, CD116, CSF2RA, CSF2R, CSF2RY) (HRP)
Sign In for Pricing
View Details 317899-02 100 µg
CSF2RA (Granulocyte-macrophage Colony-stimulating Factor Receptor Subunit alpha, GM-CSF-R-alpha, GMCSFR-alpha, GMR-alpha, CDw116, CD116, CSF2RA, CSF2R, CSF2RY) (HRP)
Sign In for Pricing
View Details