Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_778555 (POPTRDRAFT_778555)

This Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_778555 (POPTRDRAFT_778555) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

CASP-like protein POPTRDRAFT_778555

UniProt

B9IK21

Expression Region

1-164

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDVEIPPLVKQIVRGLRGLAFLATILATSFMAASHERAIFPFDYKADYTDLMLFKAFLG ANIAASLYSFFFVCLPPKSLLWRLAIVLDVIMFGLLVAMDSAAIAAAYLHKHGDSQAFWP PICSQVPTYCYRVILAISIGFGGVFMFLLIIIISISVILNPLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-500 1x 500 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), CF568 conjugate, 0.1mg/mL
BNC681629-100 1x 100 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF405S conjugate, 0.1mg/mL
BNC042904-500 1x 500 µL

WIPI2 (2A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 (DG1/447), CF740 conjugate, 0.1mg/mL
BNC740447-100 1x 100 µL

DOG-1 (DG1/447), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details