Recombinant Azotobacter vinelandii UPF0114 protein Avin_40830 (Avin_40830)
This Recombinant Azotobacter vinelandii UPF0114 protein Avin_40830 (Avin_40830) spans the amino acid sequence from region 1-164.
Product Specifications
Product Name Alternative
UPF0114 protein Avin_40830
UniProt
C1DEB0
Expression Region
1-164
Origin
Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MERFLENAMYASRWLLAPIYIGLSVALLALTLKFFQEVYHLLPHVLEMAEAELILVLLSM IDMALVGGLLVMVMISGYENFVSQLDIDEGKEKLDWLGKMDSGSLKLKVAASIVAISSIH LLRVFMDAQKIPNDKLLWYVLIHMTFVVSAFVMSYLEKMAKHAH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400563-500 1x 500 µL
Cytokeratin 18 (DE-K18), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471922-500 1x 500 µL
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881284-500 1x 500 µL
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400252-500 1x 500 µL
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details