Recombinant Rat Rhomboid-related protein 1 (Rhbdl1)
This Recombinant Rat Rhomboid-related protein 1 (Rhbdl1) spans the amino acid sequence from region 1-164.
Product Specifications
Product Name Alternative
Rhomboid-related protein 1, RRP, EC= 3.4.21.105, Rhomboid-like protein 1
UniProt
O88779
Expression Region
1-164
Origin
Rattus norvegicus (Rat)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
FMHVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVGGS GGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQP SFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740977-500 1x 500 µL
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC700977-500 1x 500 µL
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882207-500 1x 500 µL
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942755-100 1x 100 µL
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details