Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized MFS-type transporter yitZ (yitZ)

This Recombinant Bacillus subtilis Uncharacterized MFS-type transporter yitZ (yitZ) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

Uncharacterized MFS-type transporter yitZ

UniProt

P70952

Expression Region

1-164

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFFASSLIFPFYILFVKNIGSSYTQFGFSYGLFGLSGALIYPLLGRLSERFDSRYFLLLN SWGMAVLLLYVPHIGSVVQVYIVQVLLGLFGAMQKHGEKVLIANFTDSGERGKKIGNYHF WTAVFSAAAIMLGGFLADFFTVQMIFYASSILYFLSGLMMMKTG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFN, ID (SFN, HME1, 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin) (MaxLight 405)
MBS6346608-01 0.1 mL

SFN, ID (SFN, HME1, 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin) (MaxLight 405)

Sign In for Pricing
View Details
SFN, ID (SFN, HME1, 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin) (MaxLight 405)
MBS6346608-02 5x 0.1 mL

SFN, ID (SFN, HME1, 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin) (MaxLight 405)

Sign In for Pricing
View Details
SIR1 Antibody
orb851505 2 mg

SIR1 Antibody

Sign In for Pricing
View Details
Nadecnemab (Anti-GFRA3)
C00280-1mg*25 25x 1mg

Nadecnemab (Anti-GFRA3)

Sign In for Pricing
View Details
Zbtb33 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3682007 1.0 µg DNA

Zbtb33 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
2-Fluoro-N- (furan-2-ylmethyl) benzene-1-sulfonamide
EXA43890-01 250 mg

2-Fluoro-N- (furan-2-ylmethyl) benzene-1-sulfonamide

Sign In for Pricing
View Details