Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized MFS-type transporter yitZ (yitZ)

This Recombinant Bacillus subtilis Uncharacterized MFS-type transporter yitZ (yitZ) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

Uncharacterized MFS-type transporter yitZ

UniProt

P70952

Expression Region

1-164

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFFASSLIFPFYILFVKNIGSSYTQFGFSYGLFGLSGALIYPLLGRLSERFDSRYFLLLN SWGMAVLLLYVPHIGSVVQVYIVQVLLGLFGAMQKHGEKVLIANFTDSGERGKKIGNYHF WTAVFSAAAIMLGGFLADFFTVQMIFYASSILYFLSGLMMMKTG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIM (CD5L) (NM_005894) Human Over-expression Lysate
LY401793 100 µg

AIM (CD5L) (NM_005894) Human Over-expression Lysate

Sign In for Pricing
View Details
LSm3 Antibody
E38QA4982 100 µL

LSm3 Antibody

Sign In for Pricing
View Details
TIMP3 Blocking Peptide
MBS9625805-01 1 mg

TIMP3 Blocking Peptide

Sign In for Pricing
View Details
TIMP3 Blocking Peptide
MBS9625805-02 5x 1 mg

TIMP3 Blocking Peptide

Sign In for Pricing
View Details
Anti-DNAJC16 Antibody
CTA2939-01 30 µL

Anti-DNAJC16 Antibody

Sign In for Pricing
View Details
Anti-DNAJC16 Antibody
CTA2939-02 50 μL

Anti-DNAJC16 Antibody

Sign In for Pricing
View Details