Recombinant Janthinobacterium sp. Lipoprotein signal peptidase (lspA)
This Recombinant Janthinobacterium sp. Lipoprotein signal peptidase (lspA) spans the amino acid sequence from region 1-165.
Product Specifications
Product Name Alternative
Lipoprotein signal peptidase, EC= 3.4.23.36, Prolipoprotein signal peptidase, Signal peptidase II, SPase II
UniProt
A6SW70
Expression Region
1-165
Origin
Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MASNKRYFSSSSSMLPWLGIAAVLVLLDQITKITITRLFVYGESHAVTSFFNLVLVYNKG AAFSFLASETGWQRYFFTIMGIGAAIFIIYLLKKHAGQRLFCWALALILGGAIGNVIDRV LYGHVIDFLDVHIGGWHWPAFNIADSAICIGAVLFIYDELRRVGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881825-500 1x 500 µL
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880709-100 1x 100 µL
Human Kappa Light Chain (KLC709), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942347-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details