Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein NKG7 (NKG7)

This Recombinant Human Protein NKG7 (NKG7) spans the amino acid sequence from region 1-165.

Product Specifications

Product Name Alternative

Protein NKG7, G-CSF-induced gene 1 protein, GIG-1 protein, Granule membrane protein of 17 kDa, GMP-17, Natural killer cell protein 7, p15-TIA-1

UniProt

Q16617

Expression Region

1-165

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQT FSIMAVLWALVSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQP PHPQIQTFFSWSFYLGWVSAILLLCTGALSLGAHCGGPRPGYETL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-100 1x 100 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-500 1x 500 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (OCA1/812), CF568 conjugate, 0.1mg/mL
BNC680812-100 1x 100 µL

Tyrosinase (OCA1/812), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF647 conjugate, 0.1mg/mL
BNC472332-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), CF647 conjugate, 0.1mg/mL
BNC470705-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details