Recombinant Human Protein NKG7 (NKG7)
This Recombinant Human Protein NKG7 (NKG7) spans the amino acid sequence from region 1-165.
Product Specifications
Product Name Alternative
Protein NKG7, G-CSF-induced gene 1 protein, GIG-1 protein, Granule membrane protein of 17 kDa, GMP-17, Natural killer cell protein 7, p15-TIA-1
UniProt
Q16617
Expression Region
1-165
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQT FSIMAVLWALVSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQP PHPQIQTFFSWSFYLGWVSAILLLCTGALSLGAHCGGPRPGYETL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940029-100 1x 100 µL
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680812-100 1x 100 µL
Tyrosinase (OCA1/812), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472332-100 1x 100 µL
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470705-500 1x 500 µL
MART-1 / Melan-A (M2-7C10 + M2-9E3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details