Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dechloromonas aromatica Disulfide bond formation protein B (dsbB)

This Recombinant Dechloromonas aromatica Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-165.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q47BA6

Expression Region

1-165

Origin

Dechloromonas aromatica (strain RCB)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MICSKVPVRAWFATLGLGCLGLVAVGMALQTLLHLAPCPLCIFQRLLYIMIGFVGLLGFV LPAGRLLWSTLAAGLGVLGFGVAAYQTWMQAFPDLAPECGFTDPNAIERLVDWLGMEWPS MFLATGFCTSRDWELLGLSMANWSVLIFAGIVAYAVLLFVRKDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphorylase B (PHKB) (NM_001031835) Human Recombinant Protein
TP307611 20 µg

Phosphorylase B (PHKB) (NM_001031835) Human Recombinant Protein

Sign In for Pricing
View Details
USHBP1 (NM_001297703) Human Tagged ORF Clone
RG239178 10 µg

USHBP1 (NM_001297703) Human Tagged ORF Clone

Sign In for Pricing
View Details
MIR8053 Human qPCR Primer Pair (MI0025889)
HP301558 200 Reactions

MIR8053 Human qPCR Primer Pair (MI0025889)

Sign In for Pricing
View Details
Human TRIM61 activation kit by CRISPRa
GA118215 1 Kit

Human TRIM61 activation kit by CRISPRa

Sign In for Pricing
View Details
IL11 Rabbit Polyclonal Antibody
TA361168 100 µL

IL11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EME2 (NM_001010865) Human Over-expression Lysate
LY423193 100 µg

EME2 (NM_001010865) Human Over-expression Lysate

Sign In for Pricing
View Details