Recombinant Cricetulus griseus P2Y purinoceptor 4 (P2RY4)
This Recombinant Cricetulus griseus P2Y purinoceptor 4 (P2RY4) spans the amino acid sequence from region 1-165.
Product Specifications
Product Name Alternative
P2Y purinoceptor 4, P2Y4, P2Y4 metabotropic purinergic receptor
UniProt
P58826
Expression Region
1-165
Origin
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
SDTLYVLSLPTLVYYYAARNHWPFGTGFCKFVRFLFYWNLYCSVLFLTCISVHRYMGICH PLRALRWGRPRFASLLCLAVWLVVAGCLVPNLFFVTTSPNGTTILCHDTTRPEEFDHYVH FSSAVMVLLFGLPFLVTLVCYGLMARRLYRPLPGAGQSSSRLRSL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details