Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yahC (yahC)

This Recombinant Escherichia coli Uncharacterized protein yahC (yahC) spans the amino acid sequence from region 1-165.

Product Specifications

Product Name Alternative

Uncharacterized protein yahC

UniProt

P77219

Expression Region

1-165

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSFYAAGGGKSGFIRSLA VNYSGMVWAFFAALTAGWLASVSGLSAFWASVITTVPFSAVVVWQGRFWLLSFIPGGFLG MTLFFASGMNWTVTLLGFLAGNCVGVISEYGGQKLSEATTKRDGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS645805 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Faropenem Sodium Salt Hemipentahydrate
TRC-F103300-25MG 25 mg

Faropenem Sodium Salt Hemipentahydrate

Sign In for Pricing
View Details
Mouse Atpif1 activation kit by CRISPRa
GA200343 1 Kit

Mouse Atpif1 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Octen-2-one
TRC-O456005-1G 1 g

3-Octen-2-one

Sign In for Pricing
View Details
Human mTOR (Mammalian Target of Rapamycin) ELISA Kit
E-EL-H1655-01 24 Tests

Human mTOR (Mammalian Target of Rapamycin) ELISA Kit

Sign In for Pricing
View Details
Human mTOR (Mammalian Target of Rapamycin) ELISA Kit
E-EL-H1655-02 48 Tests

Human mTOR (Mammalian Target of Rapamycin) ELISA Kit

Sign In for Pricing
View Details