Recombinant Escherichia coli Uncharacterized protein yahC (yahC)
This Recombinant Escherichia coli Uncharacterized protein yahC (yahC) spans the amino acid sequence from region 1-165.
Product Specifications
Product Name Alternative
Uncharacterized protein yahC
UniProt
P77219
Expression Region
1-165
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSFYAAGGGKSGFIRSLA VNYSGMVWAFFAALTAGWLASVSGLSAFWASVITTVPFSAVVVWQGRFWLLSFIPGGFLG MTLFFASGMNWTVTLLGFLAGNCVGVISEYGGQKLSEATTKRDGY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683294-500 1x 500 µL
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3294), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP322379M 100 µg
AIP1 (MAGI2) (NM_012301) Human Recombinant Protein
Sign In for Pricing
View Details 
H-6401-1 1 mg
HRP Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-
Sign In for Pricing
View Details 