Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azoarcus sp. Disulfide bond formation protein B (dsbB)

This Recombinant Azoarcus sp. Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-166.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

A1KAY2

Expression Region

1-166

Origin

Azoarcus sp. (strain BH72)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIALPRNRRPLFLAVFAYCAALLAFGLYLQHYQGIEPCPMCIMQRYAFALVGVIALVAGL HGPRGAGVRVYGGLLLLTALAGGSVAARQTWMQLYPPEIPECGPGLEYMLESFPLTSALP MIFRGAGDCSAIDWTFLGLSLANWSLLNFGAAALLALWLLFGRRVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Pentyl Acetoacetate
288378-01 10 g

3-Pentyl Acetoacetate

Sign In for Pricing
View Details
3-Pentyl Acetoacetate
288378-02 25 g

3-Pentyl Acetoacetate

Sign In for Pricing
View Details
3-Pentyl Acetoacetate
288378-03 50 g

3-Pentyl Acetoacetate

Sign In for Pricing
View Details
3-Pentyl Acetoacetate
288378-04 100 g

3-Pentyl Acetoacetate

Sign In for Pricing
View Details
3-Pentyl Acetoacetate
288378-05 250 g

3-Pentyl Acetoacetate

Sign In for Pricing
View Details
Threonine Synthase-Like 2 (THNSL2) Rat ELISA Kit
H5826 96 Tests

Threonine Synthase-Like 2 (THNSL2) Rat ELISA Kit

Sign In for Pricing
View Details