Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharophagus degradans Disulfide bond formation protein B (dsbB)

This Recombinant Saccharophagus degradans Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-166.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q21EN9

Expression Region

1-166

Origin

Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKITKLPSYRQTALIIFAGCVGLILAALYMQEVLGLHPCPLCITQRIFIIGVGLISLIAA IHNPAALGRKVYGCLATLSGVIGAGVSARHVWLQNLPEDQVPACGPDLAYMFDAFPLLDA LKLLFAGDGNCADVVASFLGLSIPGWTFVAFVGLIAISVWQGLRKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-500 1x 500 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF647 conjugate, 0.1mg/mL
BNC472123-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (P/T1), CF647 conjugate, 0.1mg/mL
BNC470787-100 1x 100 µL

TGFalpha (P/T1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF405S conjugate, 0.1mg/mL
BNC041448-500 1x 500 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), Biotin conjugate, 0.1mg/mL
BNCB0050-500 1x 500 µL

IgA Secretory Component (SC05), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details