Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lipoprotein signal peptidase (lspA)

This Recombinant Lipoprotein signal peptidase (lspA) spans the amino acid sequence from region 1-166.

Product Specifications

Product Name Alternative

Lipoprotein signal peptidase, EC= 3.4.23.36, Prolipoprotein signal peptidase, Signal peptidase II, SPase II

UniProt

Q8Z9N1

Expression Region

1-166

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGSWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADTAICIGAALIVLEGFLPKPTAKEQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-500 1x 500 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF488A conjugate, 0.1mg/mL
BNC881553-100 1x 100 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinol Binding Protein-1 (G4E4), CF568 conjugate, 0.1mg/mL
BNC680855-100 1x 100 µL

Retinol Binding Protein-1 (G4E4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF740 conjugate, 0.1mg/mL
BNC741556-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11), CF568 conjugate, 0.1mg/mL
BNC680470-500 1x 500 µL

CD45 / LCA (2B11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details