Recombinant Sulfolobus solfataricus UPF0290 protein SSO0776 (SSO0776)
This Recombinant Sulfolobus solfataricus UPF0290 protein SSO0776 (SSO0776) spans the amino acid sequence from region 1-166.
Product Specifications
Product Name Alternative
UPF0290 protein SSO0776
UniProt
Q9UXG3
Expression Region
1-166
Origin
Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSIAYDLLLSILIYLPAFVANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880096-500 1x 500 µL
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471037-100 1x 100 µL
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 