Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 35 (Tmem35)

This Recombinant Rat Transmembrane protein 35 (Tmem35) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Transmembrane protein 35, Spinal cord expression protein 4, TMEM35 gene-derived unknown factor 1

UniProt

Q6JAM9

Expression Region

1-167

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPRTITIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV FGILLTCRLLIARKPEDRSSEKKALPESAEEQPSLYEKAPQGKVKVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse IgG (H&L) Antibody Fluorescein Conjugated
orb347137 2 mg

Horse IgG (H&L) Antibody Fluorescein Conjugated

Sign In for Pricing
View Details
PPP2R2B Antibody
MBS7131614-01 0.1 mL

PPP2R2B Antibody

Sign In for Pricing
View Details
PPP2R2B Antibody
MBS7131614-02 5x 0.1 mL

PPP2R2B Antibody

Sign In for Pricing
View Details
MDR1/P Glycoprotein Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-1468R-BF647 100 µL

MDR1/P Glycoprotein Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
KIRREL3 Antibody, Biotin conjugated
MBS7110330-01 0.05 mg

KIRREL3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
KIRREL3 Antibody, Biotin conjugated
MBS7110330-02 0.1 mg

KIRREL3 Antibody, Biotin conjugated

Sign In for Pricing
View Details