Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 220 (Tmem220)

This Recombinant Mouse Transmembrane protein 220 (Tmem220) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Transmembrane protein 220

UniProt

Q8BP07

Expression Region

1-167

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPAVATWAPGLWRACNALMAAFFALAAVVQVNDPDAELWVVVYMIPAVLTLLVGFNPLV TGNFIWKSVSAIHMLFCALWAGGLAYHFLLHAKQNLLNEEEGRELSGLVIVTAWMALCHS SSKNPGGGRMHLAIAVVITLLPLLSWVYVHMNKEMRSSWPTHCKTVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBR3 (NM_001236) Human Over-expression Lysate
LY420049 100 µg

CBR3 (NM_001236) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung: left upper lobe
CP565677 150 µg

Tissue Protein Lysate, Lung: left upper lobe

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF568 conjugate, 0.1mg/mL
BNC680893-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ankmy2 Mouse Gene Knockout Kit (CRISPR)
KN501260 1 Kit

Ankmy2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Complement C7 (C7) Goat Polyclonal Antibody
AP32959PU-N 100 µg

Complement C7 (C7) Goat Polyclonal Antibody

Sign In for Pricing
View Details
TentaGel® M RAM
M301023.25G 25 g

TentaGel® M RAM

Sign In for Pricing
View Details