Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Transmembrane protein 229B (TMEM229B)

This Recombinant Chicken Transmembrane protein 229B (TMEM229B) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Transmembrane protein 229B

UniProt

Q5F3L7

Expression Region

1-167

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAEPLTAFSRWYLYAIHGYFCEVMFTAAWEFVVNFNWKFPGVTSVWALFIYGTSILIV EKMYLYLKDKCHILVRCFIYTLWTYLWEFTTGLILRQFNACPWDYSQFDFDFMGLITLEY AIPWFCASFIMEQLVIRNTLRLRFDETAEPGAPTVPVALANGHVKTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRRAP Rabbit Polyclonal Antibody
HA500431 100 µL

TRRAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ovary specific acidic protein (MGARP) Human Gene Knockout Kit (CRISPR)
KN416908 1 Kit

Ovary specific acidic protein (MGARP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Xylella fastidiosa TaqMan Probe/Primer and Control Set
TM67010 100 Units

Xylella fastidiosa TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right lower lobe
CS646098 5x 5 µm

Frozen Tissue Sections, Lung: right lower lobe

Sign In for Pricing
View Details
Human LRRC3C activation kit by CRISPRa
GA119278 1 Kit

Human LRRC3C activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS506998 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details