Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Transmembrane protein 229B (TMEM229B)

This Recombinant Chicken Transmembrane protein 229B (TMEM229B) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Transmembrane protein 229B

UniProt

Q5F3L7

Expression Region

1-167

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAEPLTAFSRWYLYAIHGYFCEVMFTAAWEFVVNFNWKFPGVTSVWALFIYGTSILIV EKMYLYLKDKCHILVRCFIYTLWTYLWEFTTGLILRQFNACPWDYSQFDFDFMGLITLEY AIPWFCASFIMEQLVIRNTLRLRFDETAEPGAPTVPVALANGHVKTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Skp1 p19 shRNA (h) Lentiviral Particles
sc-29482-V 200 µL

Skp1 p19 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
MUM1L1 Protein Vector (Mouse) (pPB-N-His)
PV203051 500 ng

MUM1L1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
LRRC34 Protein Vector (Mouse) (pPM-C-HA)
PV197640 500 ng

LRRC34 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PGF (Prostaglandin F) ELISA Kit
MBS2533662-01 24 Tests

PGF (Prostaglandin F) ELISA Kit

Sign In for Pricing
View Details
PGF (Prostaglandin F) ELISA Kit
MBS2533662-02 48 Test

PGF (Prostaglandin F) ELISA Kit

Sign In for Pricing
View Details
PGF (Prostaglandin F) ELISA Kit
MBS2533662-03 96 Tests

PGF (Prostaglandin F) ELISA Kit

Sign In for Pricing
View Details