Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 229B (TMEM229B)

This Recombinant Mouse Transmembrane protein 229B (TMEM229B) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

Transmembrane protein 229B

UniProt

Q8BFQ2

Expression Region

1-167

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNFNWKFPGVTSVWALFIYGTSILIV ERMYLRLRGRCPLLVRCVIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEY AVPWFCGALIMEQFIIRNTLRLRFDKDAEPGEPASPPALANGHVKTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITM2 Human Gene Knockout Kit (CRISPR)
KN420482 1 Kit

FITM2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MAP3K19 activation kit by CRISPRa
GA112822 1 Kit

Human MAP3K19 activation kit by CRISPRa

Sign In for Pricing
View Details
Zfp180 Mouse Gene Knockout Kit (CRISPR)
KN519741 1 Kit

Zfp180 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OXCT2 (NM_022120) Human Over-expression Lysate
LC402907 20 µg

OXCT2 (NM_022120) Human Over-expression Lysate

Sign In for Pricing
View Details
tert-Butyl Diazoacetate, 85%
TRC-B691035-5G 5 g

tert-Butyl Diazoacetate, 85%

Sign In for Pricing
View Details
CD63 (NM_001780) Human Over-expression Lysate
LC419757 20 µg

CD63 (NM_001780) Human Over-expression Lysate

Sign In for Pricing
View Details