Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus furiosus UPF0290 protein PF0398 (PF0398)

This Recombinant Pyrococcus furiosus UPF0290 protein PF0398 (PF0398) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

UPF0290 protein PF0398

UniProt

Q8U3Q8

Expression Region

1-167

Origin

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHPILEAFWYILPAYFANSSPVILGGGTPIDFGKTWRDGRRIFGDSKTWRGFLGGLTVGT LIGVIQQIIYPYYPSLSLAFKVSFLLALGALVGDLIGSFIKRRLNLPPGYPAVGLDQWGF LISALCFAYPVHTIPTGEVLLLLVVTPLIHWGTNVLAYKMKWKSVPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-500 1x 500 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-500 1x 500 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), Biotin conjugate, 0.1mg/mL
BNCB0449-500 1x 500 µL

CD104 (UM-A9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF568 conjugate, 0.1mg/mL
BNC682897-100 1x 100 µL

Major Vault Protein (MVP) (VP2897R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details