Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macropus robustus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

This Recombinant Macropus robustus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6) spans the amino acid sequence from region 1-167.

Product Specifications

Product Name Alternative

NADH-ubiquinone oxidoreductase chain 6, EC= 1.6.5.3, NADH dehydrogenase subunit 6

UniProt

P92670

Expression Region

1-167

Origin

Macropus robustus (Wallaroo) (Euro)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKMMVVFLFSILLVFGFVAFASKPSPVYGGLSLVVSGGLGCAIVVSLEDVFLGLIVFLIY LGGMLVVFGYTAAMATEEYPESWVGNTVALSMLLFTVIVESAWYLMSGEVKVSMDIELFD IIGGYCVGQDYSGVSLLYGCGGWALVLLGWILFITIYVVLEVVRGCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
BNC680391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 3 (M3.1), CF647 conjugate, 0.1mg/mL
BNC470990-500 1x 500 µL

Mucin 3 (M3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF405S conjugate, 0.1mg/mL
BNC041274-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details