Recombinant Bacillus subtilis Uncharacterized protein ypbQ (ypbQ)
This Recombinant Bacillus subtilis Uncharacterized protein ypbQ (ypbQ) spans the amino acid sequence from region 1-168.
Product Specifications
Product Name Alternative
Uncharacterized protein ypbQ
UniProt
P54158
Expression Region
1-168
Origin
Bacillus subtilis (strain 168)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFWLLIAILIVQRAAEMAVARQNEQKVKKQGAIEFGESHYPYIITMHILFFLSLIAEVLL MNKQPSSWWLGIAAVILSVQIVRYWALCSLGAYWNTKILVVPGVELVKKGPYKWMKHPNY AVVILEILLIPLLYQAYVTMCLFSIFNAVLLSVRIRAEDKALQEYSVK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
583719-01 20 µg
ATP-dependent RNA Helicase DDX3X, Recombinant, Human, aa2-662, His-B2M-Tag
Sign In for Pricing
View Details 583719-02 100 µg
ATP-dependent RNA Helicase DDX3X, Recombinant, Human, aa2-662, His-B2M-Tag
Sign In for Pricing
View Details 
orb1675549 96 Tests
Human Prolyl 4-hydroxylase subunit alpha-1 ELISA Kit
Sign In for Pricing
View Details