Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypbQ (ypbQ)

This Recombinant Bacillus subtilis Uncharacterized protein ypbQ (ypbQ) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

Uncharacterized protein ypbQ

UniProt

P54158

Expression Region

1-168

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFWLLIAILIVQRAAEMAVARQNEQKVKKQGAIEFGESHYPYIITMHILFFLSLIAEVLL MNKQPSSWWLGIAAVILSVQIVRYWALCSLGAYWNTKILVVPGVELVKKGPYKWMKHPNY AVVILEILLIPLLYQAYVTMCLFSIFNAVLLSVRIRAEDKALQEYSVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Cadherin-23 (CDH23) ELISA Kit
MBS7225221-01 48 Well

Monkey Cadherin-23 (CDH23) ELISA Kit

Sign In for Pricing
View Details
Monkey Cadherin-23 (CDH23) ELISA Kit
MBS7225221-02 96 Well

Monkey Cadherin-23 (CDH23) ELISA Kit

Sign In for Pricing
View Details
Monkey Cadherin-23 (CDH23) ELISA Kit
MBS7225221-03 5x 96 Well

Monkey Cadherin-23 (CDH23) ELISA Kit

Sign In for Pricing
View Details
Monkey Cadherin-23 (CDH23) ELISA Kit
MBS7225221-04 10x 96 Well

Monkey Cadherin-23 (CDH23) ELISA Kit

Sign In for Pricing
View Details
COL4A6 (Collagen, Type IV, alpha 6, MGC88184) (MaxLight 750) discontinued
244837-ML750 100 µL

COL4A6 (Collagen, Type IV, alpha 6, MGC88184) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CEACAM5 Rabbit Polyclonal Antibody
orb588889 100 µL

CEACAM5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details