Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Disulfide bond formation protein B 2 (dsbB2)

This Recombinant Pseudomonas putida Disulfide bond formation protein B 2 (dsbB2) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B 2, Disulfide oxidoreductase 2

UniProt

P59344

Expression Region

1-168

Origin

Pseudomonas putida (strain KT2440)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPARLRTFFLPACLVALAVLVASFRLENTVGLMPCPLCLSQRLLLGGYALLCFAAVLQA PGTRGILRYARLALGCSLAGALLAARHVWLQGAEGVNEVCPVPIGRVFEQSWSEAARQLL LGGPDCRSLAWSFLDLTLPEWSLLAFLLLAVLPLSCLLAYRFRTLART

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P-Hydroxy Diphenyl 98% For Synthesis
141000500 500 mg

P-Hydroxy Diphenyl 98% For Synthesis

Sign In for Pricing
View Details
Swi6 Antibody
6285-100 100 µg

Swi6 Antibody

Sign In for Pricing
View Details
PSMD13 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
37998066 1.0 µg DNA

PSMD13 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Olfr1402 ORF Vector (Mouse) (pORF)
32844014 1.0 µg DNA

Olfr1402 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ITIH4 Protein Vector (Human) (pPB-N-His)
PV088103 500 ng

ITIH4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CIART Human Pre-designed siRNA Set A
HY-RS02705 1 Set

CIART Human Pre-designed siRNA Set A

Sign In for Pricing
View Details