Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosospira multiformis Disulfide bond formation protein B (dsbB)

This Recombinant Nitrosospira multiformis Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q2YA85

Expression Region

1-168

Origin

Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNPMRPVRSILLAIFTGCAGLIGYALYLQLVENLLPCPLCVVQRMAYWLIGLTALAGFF HTPETTGRRIYAGLMAVFAFTGGLVALRQAWLVRYPEAFECGISPEEAFLNALPLARWWP VMFEANGDCADVTWKFASLTLPDWSAIFFMILAALSIYVLLVRENQRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DispensMate 5-60mL
7032100107 1 Unit

DispensMate 5-60mL

Sign In for Pricing
View Details
Beclin 1 (h2) -PR
sc-44286-PR 10 µM - 20 µL

Beclin 1 (h2) -PR

Sign In for Pricing
View Details
Lrmp ORF Vector (Mouse) (pORF)
27601014 1.0 µg DNA

Lrmp ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
DNTP Mix (10 mM)
abx461013-01 1 mL

DNTP Mix (10 mM)

Sign In for Pricing
View Details
DNTP Mix (10 mM)
abx461013-02 10x 1 mL

DNTP Mix (10 mM)

Sign In for Pricing
View Details
Physiological Solution (Culture media in glass tubes/bottles)
470400 6 Bottles x 250 mL (Capacity 500 mL)

Physiological Solution (Culture media in glass tubes/bottles)

Sign In for Pricing
View Details