Mucin-2/MUC2, Human (His)
Mucin-2/MUC2 Protein, Human (His) is the recombinant human-derived Mucin-2/MUC2, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Mucin-2/MUC2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mucin-2-muc2-protein-human-his.html
Purity
90.00
Smiles
VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Molecular Formula
4583 (Gene_ID) Q02817 (V36-L240) (Accession)
Molecular Weight
34 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040460-100 1x 100 µL
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details