Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R513 (MIMI_R513)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R513 (MIMI_R513) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

Uncharacterized protein R513

UniProt

Q5UQ82

Expression Region

1-168

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDVTVTPSATSKLTGILKPGSYEIEKGHFSRYFSLNWWQLIVVVGIAISGIAAIANTYD AITGVDKDIEGCENVSNLRKKLEAKFIIIIVLSCLAVVGGIILAWLLRSGTNQRKLLTMG LTTGGILGILYALTIRFRGTSNMVKLGISWVSLLAFVLLGFFINTSGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nkiras2 Mouse shRNA Lentiviral Particle (Locus ID 71966)
TL515380V 500 µL Each

Nkiras2 Mouse shRNA Lentiviral Particle (Locus ID 71966)

Sign In for Pricing
View Details
Mouse Cdh12 (NM_001008420) AAV Particle
MR210697A1V 250 µL

Mouse Cdh12 (NM_001008420) AAV Particle

Sign In for Pricing
View Details
TFIP11 Lentiviral Activation Particles (h2)
sc-407684-LAC-2 200 µL

TFIP11 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Collagen Type X (COL10)
MBS2086796-01 0.01 mg

Recombinant Collagen Type X (COL10)

Sign In for Pricing
View Details
Recombinant Collagen Type X (COL10)
MBS2086796-02 0.05 mg

Recombinant Collagen Type X (COL10)

Sign In for Pricing
View Details
Recombinant Collagen Type X (COL10)
MBS2086796-03 0.1 mg

Recombinant Collagen Type X (COL10)

Sign In for Pricing
View Details