Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neurospora crassa Protein yop-1 (yop-1)

This Recombinant Neurospora crassa Protein yop-1 (yop-1) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

Protein yop-1

UniProt

Q871R7

Expression Region

1-168

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSPQDRAQQYIGQLDKELSKYPTLNNLEKTTGVPKAYAVIGLVALYFFLIIFNLGGQLL TNLAGFVLPGYYSLNALFTASKQDDTQWLTYWVVFSLFTVIESLISVVYWFPFYFTFKFV FLLWLSLPTFKGAETIFRSFLAPTLGRYFQNGSTASGLRAKADAVHTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-100 1x 100 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-100 1x 100 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-500 1x 500 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details