Recombinant Drosophila melanogaster Mpv17-like protein (CG11077)
This Recombinant Drosophila melanogaster Mpv17-like protein (CG11077) spans the amino acid sequence from region 1-168.
Product Specifications
Product Name Alternative
Mpv17-like protein
UniProt
Q9V492
Expression Region
1-168
Origin
Drosophila melanogaster (Fruit fly)
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKRLKAYLKDGINVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRW YHFLESRVPKTYSPMRRGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSY LSILVRNYMLWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLSMILNS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471725-500 1x 500 µL
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941384-100 1x 100 µL
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882562-500 1x 500 µL
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details