Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Putative gustatory receptor clone PTE03 (Olr1145)

This Recombinant Rat Putative gustatory receptor clone PTE03 (Olr1145) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

Putative gustatory receptor clone PTE03

UniProt

P35895

Expression Region

1-168

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TTVPKMLINLQKQNKAISYAGCITQLSFVLLFAGMENFLLAAMAYDRYVAICKPLRYTAI MKAHLCLVMTLLSLCISIVDALLHGLMILRLSFCTFLEIPHYFCELYQVIKLSCSDTLIN NILVYTMTSTLGGVPLGGIIFSYFKIISSILRMPSSGSRHRAFSTCGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melamine
TRC-M208700-1G 1 g

Melamine

Sign In for Pricing
View Details
Tissue FFPE Sections, Duodenum
CS710225 5x 5 µm

Tissue FFPE Sections, Duodenum

Sign In for Pricing
View Details
OR10C1 Human Gene Knockout Kit (CRISPR)
KN417723 1 Kit

OR10C1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethyl 3-oxo-2-Phenylpropanoate (>90%)
TRC-B441355-50MG 50 mg

Ethyl 3-oxo-2-Phenylpropanoate (>90%)

Sign In for Pricing
View Details
Fructose Fluorometric Assay Kit
E-BC-F080 96 T (40 samples)

Fructose Fluorometric Assay Kit

Sign In for Pricing
View Details
DISC1 (NM_018662) Human Recombinant Protein
TP312015L 1 mg

DISC1 (NM_018662) Human Recombinant Protein

Sign In for Pricing
View Details