Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Putative gustatory receptor clone PTE03 (Olr1145)

This Recombinant Rat Putative gustatory receptor clone PTE03 (Olr1145) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

Putative gustatory receptor clone PTE03

UniProt

P35895

Expression Region

1-168

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TTVPKMLINLQKQNKAISYAGCITQLSFVLLFAGMENFLLAAMAYDRYVAICKPLRYTAI MKAHLCLVMTLLSLCISIVDALLHGLMILRLSFCTFLEIPHYFCELYQVIKLSCSDTLIN NILVYTMTSTLGGVPLGGIIFSYFKIISSILRMPSSGSRHRAFSTCGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mesothelin Recombinant Rabbit monoclonal Antibody
HA723289H 100 µL

Human Mesothelin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human ZNF853 activation kit by CRISPRa
GA110242 1 Kit

Human ZNF853 activation kit by CRISPRa

Sign In for Pricing
View Details
LRSAM1 (NM_001005373) Human Over-expression Lysate
LC423706 20 µg

LRSAM1 (NM_001005373) Human Over-expression Lysate

Sign In for Pricing
View Details
EIF4E Mouse Monoclonal Antibody [Clone ID: 5D11]
AM06602SU-N 100 µL

EIF4E Mouse Monoclonal Antibody [Clone ID: 5D11]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Virus,  20nm
GM-602-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Virus, 20nm

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF647 conjugate, 0.1mg/mL
BNC472027-500 1x 500 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details