Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella amazonensis Disulfide bond formation protein B (dsbB)

This Recombinant Shewanella amazonensis Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

A1S6X5

Expression Region

1-169

Origin

Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSLISFAHSRLSWGILALSALALESAALYFQHIMKLDPCVMCIYQRVAVFGLLGAGLFG FMAPANRVIRALGALLWGISAAWGLKLALELVDMQNNPNPFSTCSFLPEFPSWLQLHEWL PSVFMPTGMCTDIPWEFAGVTMGEWMIVAFSVYLLAWLAFIVPMLKKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELOVL5
CSB-CL882144HU 10 μg Plasmid + 200 μL Glycerol

ELOVL5

Sign In for Pricing
View Details
API5 Protein Vector (Mouse) (pPM-C-His)
PV155181 500 ng

API5 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Human Meprin A Beta ELISA Kit
MBS068276-01 48 Well

Human Meprin A Beta ELISA Kit

Sign In for Pricing
View Details
Human Meprin A Beta ELISA Kit
MBS068276-02 96 Well

Human Meprin A Beta ELISA Kit

Sign In for Pricing
View Details
Human Meprin A Beta ELISA Kit
MBS068276-03 5x 96 Well

Human Meprin A Beta ELISA Kit

Sign In for Pricing
View Details
Human Meprin A Beta ELISA Kit
MBS068276-04 10x 96 Well

Human Meprin A Beta ELISA Kit

Sign In for Pricing
View Details