Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 2A (Cmtm2a)

This Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 2A (Cmtm2a) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

CKLF-like MARVEL transmembrane domain-containing protein 2A, Chemokine-like factor superfamily member 2A

UniProt

Q9DAR1

Expression Region

1-169

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPIKFPFRPRGGQPREDTTPKRGLRRYLLELKESNKEFWLSGHAVFKLLSLGCMISAL DYFETMLPHPVLILLICMEAAICIFFIFLNTLAINRYIPFVFWPMADIFNSLFSCVFLGG GIYFAFKARRLLPKPYLTAMILMGAAAICSFIDMLLQFQHFRGLRLRKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOB4 Polyclonal Antibody
RD252342A-01 20 µL

MOB4 Polyclonal Antibody

Sign In for Pricing
View Details
MOB4 Polyclonal Antibody
RD252342A-02 60 μL

MOB4 Polyclonal Antibody

Sign In for Pricing
View Details
MOB4 Polyclonal Antibody
RD252342A-03 120 μL

MOB4 Polyclonal Antibody

Sign In for Pricing
View Details
MOB4 Polyclonal Antibody
RD252342A-04 200 µL

MOB4 Polyclonal Antibody

Sign In for Pricing
View Details
GNAI2 Rabbit Polyclonal Antibody
orb1174991 100 µg

GNAI2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Afegostat
T72998-01 25 mg

L-Afegostat

Sign In for Pricing
View Details