What is the catalog number for Recombinant Sheep Translocator protein (TSPO)?

The catalog number for Recombinant Sheep Translocator protein (TSPO) is orb2920084.

What sizes are available for Recombinant Sheep Translocator protein (TSPO)?

Recombinant Sheep Translocator protein (TSPO) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Sheep Translocator protein (TSPO) come in?

Recombinant Sheep Translocator protein (TSPO) is available in 2 different pack sizes.

Is Recombinant Sheep Translocator protein (TSPO) in stock?

Recombinant Sheep Translocator protein (TSPO) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Sheep Translocator protein (TSPO)

This Recombinant Sheep Translocator protein (TSPO) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

Translocator protein, Peripheral-type benzodiazepine receptor, PBR

UniProt

Q9GMC9

Expression Region

1-169

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPPWVPAVGFTLVPSPGGFLGTQYIRGEGFRWYASLQKPPWHPPRWILAPIWGTLYSAM GYGSYLIWKELGGFSKEAVVPLGLYAGQLALNWAWPPLFFGARQMGWAFVDLLLTGGMAA ATAMAWRQVSPPAACLLYPYLAWLAFAAMLNYRMWQDNQGRRSGRRLSE