Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Translocator protein (TSPO)

This Recombinant Bovine Translocator protein (TSPO) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

Translocator protein, Isoquinoline-binding protein, IBP, PKBS, Peripheral-type benzodiazepine receptor, PBR

UniProt

P30535

Expression Region

1-169

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPPWVPAVGFTLLPSLGGFLGAQYTRGEGFRWYASLQKPPWHPPRWILAPIWGTLYSAM GYGSYMIWKELGGFSKEAVVPLGLYAGQLALNWAWPPLFFGTRQMGWALVDLLLTGGMAA ATAMAWHQVSPPAACLLYPYLAWLAFAGMLNYRMWQDNQVRRSGRRLSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGLT1 (SLC5A1) (NM_000343) Human Over-expression Lysate
LY400126 100 µg

SGLT1 (SLC5A1) (NM_000343) Human Over-expression Lysate

Sign In for Pricing
View Details
Calcipressin 1 (RCAN1) Human Gene Knockout Kit (CRISPR)
KN202391LP 1 Kit

Calcipressin 1 (RCAN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBE2Q2 (NM_001145335) Human Over-expression Lysate
LC428824 20 µg

UBE2Q2 (NM_001145335) Human Over-expression Lysate

Sign In for Pricing
View Details
n-Undecanoyl Chloride
TRC-U788870-500MG 500 mg

n-Undecanoyl Chloride

Sign In for Pricing
View Details
2-Iodoindole
TRC-I707390-250MG 250 mg

2-Iodoindole

Sign In for Pricing
View Details
TentaGel® S NH₂
S30902.100G 100 g

TentaGel® S NH₂

Sign In for Pricing
View Details