Recombinant Haemophilus influenzae Uncharacterized transporter HI_0976.1 (HI_0976.1)
This Recombinant Haemophilus influenzae Uncharacterized transporter HI_0976.1 (HI_0976.1) spans the amino acid sequence from region 1-170.
Product Specifications
Product Name Alternative
Uncharacterized transporter HI_0976.1
UniProt
O86230
Expression Region
1-170
Origin
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAFIGVAILINGGKNNEGIDNISLFGCLLVLSAGIIFAAVLRWTQRVVAKVSTQAYTSVS IVLGTITTLPFTLLLTENWQISLNSTGIAGLLYLAIGCSWLAYWLWNKGLNSVDANISGV LVALEPLFGILFAVSLLGETLSFSAALGITIIMLATLGSTLLPKLLKKSV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470040-500 1x 500 µL
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942276-500 1x 500 µL
CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details