Recombinant Burkholderia cenocepacia Disulfide bond formation protein B (dsbB)
This Recombinant Burkholderia cenocepacia Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-170.
Product Specifications
Product Name Alternative
Disulfide bond formation protein B, Disulfide oxidoreductase
UniProt
Q1BY52
Expression Region
1-170
Origin
Burkholderia cenocepacia (strain AU 1054)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNDYTLALRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFCAIGIFAFL AAGIRNWRGVWVLELLIAIAAAGGVGTAARHLSIQMNPGFSCGFDTLQPIVDSLPPAQWF PGMFKVAGLCETVYPPIFGILLPGWALIGFAVILVAVVASLWRHRRKLAS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
