Recombinant Xenopus laevis MARVEL domain-containing protein 1 (marveld1)
This Recombinant Xenopus laevis MARVEL domain-containing protein 1 (marveld1) spans the amino acid sequence from region 1-170.
Product Specifications
Product Name Alternative
MARVEL domain-containing protein 1
UniProt
Q6GPN9
Expression Region
1-170
Origin
Xenopus laevis (African clawed frog)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEGERPRSDTVTTTVSSHMETISLGGSIAYDRSFLRSPTGVLLLMEIMFGLLVWALIAGS EYFLFSAFGWVMFVAVFYWVLSVFFFLLHLTRANTRITKVPWSLVGLCFNGSAFVLYLIA AVVEASSVNKDVHQHHNYNSWTASSFFAFIVTVCYALSTYFSFQAWRTKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6463785-01 0.1 mL
APOER2, CT (Low Density Lipoprotein Receptor-related Protein 8, LRP-8, Apolipoprotein E Receptor 2, LRP8) (MaxLight 650)
Sign In for Pricing
View Details MBS6463785-02 5x 0.1 mL
APOER2, CT (Low Density Lipoprotein Receptor-related Protein 8, LRP-8, Apolipoprotein E Receptor 2, LRP8) (MaxLight 650)
Sign In for Pricing
View Details 
AFG-FLL-099 10 mL
Working anti-canine IgM (Fc) -FITC Conjugate (10mL)
Sign In for Pricing
View Details 
