Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Disulfide bond formation protein B (dsbB)

This Recombinant Acinetobacter baumannii Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

A3MA10

Expression Region

1-171

Origin

Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLSYRLVSGLLVLASIVGMSFALYLEHVKGLEPCPLCIFQRVGLMAMGFVALIAFLHNP VSNAIKRFYAFLAGVAILWSVGVAGRHVWLQHLPPDQVPSCGPGLNYLIDALPMKTVLQE VLSGSGECAAIDWTFLGQSLPVWSLAYFLLLLLVCLWQLFRFYPVFKTAKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCF2 (NM_001171878) Human Over-expression Lysate
LC433549 20 µg

MCF2 (NM_001171878) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human SOCS3/CIS3 Protein (His & Trx Tag)
PKSH031151 50 µg

Recombinant Human SOCS3/CIS3 Protein (His & Trx Tag)

Sign In for Pricing
View Details
ZC3H14 (NM_207662) Human Over-expression Lysate
LY403936 100 µg

ZC3H14 (NM_207662) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF781 activation kit by CRISPRa
GA116077 1 Kit

Human ZNF781 activation kit by CRISPRa

Sign In for Pricing
View Details
C9orf117 (CFAP157) (NM_001012502) Human Over-expression Lysate
LY422870 100 µg

C9orf117 (CFAP157) (NM_001012502) Human Over-expression Lysate

Sign In for Pricing
View Details
Cfap65 Mouse Gene Knockout Kit (CRISPR)
KN502633 1 Kit

Cfap65 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details