Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Disulfide bond formation protein B (dsbB)

This Recombinant Acinetobacter baumannii Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

A3MA10

Expression Region

1-171

Origin

Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLSYRLVSGLLVLASIVGMSFALYLEHVKGLEPCPLCIFQRVGLMAMGFVALIAFLHNP VSNAIKRFYAFLAGVAILWSVGVAGRHVWLQHLPPDQVPSCGPGLNYLIDALPMKTVLQE VLSGSGECAAIDWTFLGQSLPVWSLAYFLLLLLVCLWQLFRFYPVFKTAKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Napsin-A (NAPSA/1239), CF405S conjugate, 0.1mg/mL
BNC041239-100 1x 100 µL

Napsin-A (NAPSA/1239), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Snx7 Mouse Gene Knockout Kit (CRISPR)
KN516448 1 Kit

Snx7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANXA3 Antibody
KC-1378-01 50 μL

ANXA3 Antibody

Sign In for Pricing
View Details
ANXA3 Antibody
KC-1378-02 100 µL

ANXA3 Antibody

Sign In for Pricing
View Details
ANXA3 Antibody
KC-1378-03 1 mL

ANXA3 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708645 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details