Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter sp. Disulfide bond formation protein B (dsbB)

This Recombinant Psychrobacter sp. Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

A5WBG4

Expression Region

1-171

Origin

Psychrobacter sp. (strain PRwf-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRLLTYRALNFILFIASVVAMLFAIIFLQNYKGLEPCPLCIFQRIGLMVMGGFSLIAAV GHPKKMGMQLLLWIGSMAGILWSAGVAARHVWIQHLPADQVPACGPGLDYFLEALPMKQV INQVLSGSGECAEISWRFLGLSIPEQALILFTALILVNLLVLWRIISKRTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diethyl a-Acetylglutarate
TRC-D443510-25G 25 g

Diethyl a-Acetylglutarate

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2887R), CF740 conjugate, 0.1mg/mL
BNC742887-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/2887R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (G2- & M-phase Cyclin) (CCNB1/2978R), CF740 conjugate, 0.1mg/mL
BNC742978-500 1x 500 µL

Cyclin B1 (G2- & M-phase Cyclin) (CCNB1/2978R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
17-Amino Geldanamycin-13C,15N2
TRC-A609702-1MG 1 mg

17-Amino Geldanamycin-13C,15N2

Sign In for Pricing
View Details
CRPPA (NM_001101417) Human Recombinant Protein
TP325626 20 µg

CRPPA (NM_001101417) Human Recombinant Protein

Sign In for Pricing
View Details
Cfap299 Mouse Gene Knockout Kit (CRISPR)
KN500065 1 Kit

Cfap299 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details