Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter sp. Disulfide bond formation protein B (dsbB)

This Recombinant Psychrobacter sp. Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

A5WBG4

Expression Region

1-171

Origin

Psychrobacter sp. (strain PRwf-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRLLTYRALNFILFIASVVAMLFAIIFLQNYKGLEPCPLCIFQRIGLMVMGGFSLIAAV GHPKKMGMQLLLWIGSMAGILWSAGVAARHVWIQHLPADQVPACGPGLDYFLEALPMKQV INQVLSGSGECAEISWRFLGLSIPEQALILFTALILVNLLVLWRIISKRTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ptprv activation kit by CRISPRa
GA201296 1 Kit

Mouse Ptprv activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS633497 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Ferritin Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-
I-1102-1 1 mg

Ferritin Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-

Sign In for Pricing
View Details
GATA1 (Ab-142) Antibody
8B7092-AAT 50 µg

GATA1 (Ab-142) Antibody

Sign In for Pricing
View Details
SGF29 Human Gene Knockout Kit (CRISPR)
KN402299 1 Kit

SGF29 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Hydroxychlorpropham-d7 Sulfate Sodium Salt
TRC-H825077-2.5MG 2.5 mg

4-Hydroxychlorpropham-d7 Sulfate Sodium Salt

Sign In for Pricing
View Details